PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00056171-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family TCP
Protein Properties Length: 468aa    MW: 50714.8 Da    PI: 7.1024
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00056171-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1181.2e-36143213373
               TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                       +kk++ +++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as++
  PSME_00056171-RA 143 KKKSSCKDRHTKVDGRGRRIRMPAACAARIFQLTKELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASAA 213
                       699999***********************************************************999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-31147248IPR005333Transcription factor, TCP
PROSITE profilePS5136926.374148202IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001047Molecular Functioncore promoter binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MANLLTSGYT SIFIVSFGVT LQAAAIFVCK TLLAVQKPVD SFASRCRLSS KSFVFVHSGL  60
RVYAADKTEK RDNSYGEDIE QRLRGSTESY VKAMHAEMDA ERVGSGSSSR AIAEDLETMS  120
GTPIPSSSTG SDLQGTNQQG IVKKKSSCKD RHTKVDGRGR RIRMPAACAA RIFQLTKELG  180
HKSDGETIQW LLQQAEPSII AATGTGTIPA SAAAMAASIG ESGNLLTDPP YGSLGFTARG  240
VSGDMILDHF ERRSLMQGAG GHEVGRFQNE GFVDEGLEMR RLREEKGIQL GHMQRNVELS  300
ERRLSVLSAA SRHFSMHESP SEGLSQIWTD SPMYRMTPEP PPSASAASIQ AGSGHITCSN  360
AMTPLTTYLL PSAMDRMPGI NLSGLELQSG HMGHMPLSAM LLQQQQQGSQ HEQHLVGVQA  420
REGQIGIIAS GSTYNNSMRS TTQDYGHHHH HHYPHEASGQ ENSYDQNP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.12e-38TCP family protein